Category: ABNOVA


  • SP7 monoclonal antibody (M01), clone 2G6 | ABNOVA | H00121340-M01

    Specification Product Description: Mouse monoclonal antibody raised against a partial recombinant SP7. Immunogen: SP7 (NP_690599, 87 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH Host: Mouse Reactivity: Human Interspecies Antigen Sequence: Mouse (94); Rat (94) Isotype: IgG2a Kappa Quality Control Testing: Antibody Reactive Against Recombinant Protein. Western Blot detection against […]


  • Goat Anti-Mouse IgG (H&L) secondary antibody (Biotin) | ABNOVA | PAB10748

    Specification Product Description: Goat anti-mouse IgG recognizes mouse IgG whole molecule. This secondary antibody was purified using antigen affinity chromatography. The antibody is conjugated with Biotin. Immunogen: Mouse IgG whole molecule Host: Goat Reactivity: Mouse Form: Lyophilized Conjugation: Biotin Purification: This product was prepared from monospecific antiserum by immunoaffinity chromatography, followed by solid phase adsorption(s) to remove any unwanted reactivities. Isotype: IgG Recommend […]

error: Content is protected !!