SP7 monoclonal antibody (M01), clone 2G6 | ABNOVA | H00121340-M01

Specification

Product Description: Mouse monoclonal antibody raised against a partial recombinant SP7.

Immunogen: SP7 (NP_690599, 87 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH

Quality Control Testing: Antibody Reactive Against Recombinant Protein.

Western Blot detection against Immunogen (34.1 KDa) .

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

QuantiChrom™ Peroxide Assay Kit | BIOASSAY SYSTEM | DIOX-250

Application For quantitative determination of peroxide and evaluation of drug effects on peroxide metabolism. Key Features Sensitive and accurate. Enhanced color intensity using sorbitol. Detection range 0.2 μM (7 ng/mL) to 30 μM (1,020 ng/mL) H2O2 in 96-well plate assay. Simple and high-throughput. The procedure involves addition of a single detection reagent and incubation for 30 […]
QuantiChrom Magnesium Assay Kit | BIOASSAY SYSTEM | DIMG-250

Application For quantitative determination of Mg2+ and evaluation of drug effects on magnesium metabolism. Key Features Sensitive and accurate. Use as little as 5 μL sample. Linear detection range 0.1 mg/dL (41 μM) to 3 mg/dL (1.2 mM) Mg2+ in 96-well plate assay. Simple and high-throughput. The procedure involves addition of two reagents and measuring OD500nm. Can […]
Glutathione Assay Kit 250Assay | BIOASSAY SYSTEM | DIGT-250

Application For quantitative determination of reduced glutathione (GSH) and evaluation of drug effects on glutathione metabolism. Key Features Sensitive and accurate. Linear detection range 0.4 – 100 μM in 96-well plate. Simple and convenient. The procedure involves mixing the DTNB Reagent with sample, removing protein precipitates for proteinaceous samples, adding a second Reagent and reading […]