Author: storegamma
-
Basic Pette Volume Fixed 500µL – BAS I CIPETTE | ACCU-TELL | BPF-500µL
BasicPette Fixed Volume Pipette 500µL CAT: ABT-BPF-500 Volume: 500µL Accuracy: ±1.2 % CV: ≤ 0.7 % Brand: Accu-Tell
-
Basic Pette Volume Fixed 100µL – BAS I CIPETTE | ACCU-TELL | BPF-100µL
BasicPette Fixed Volume Pipette 100µL CAT: ABT-BPF-100 Volume: 100µL Accuracy: ±1.5 % CV: ≤1.0 % Brand: Accu-Tell
-
Recombinant Anti-SIRT1 antibody [EPR18239] 100µl | ABCAM | ab189494
Product name Anti-SIRT1 antibody [EPR18239] See all SIRT1 primary antibodies Description Rabbit monoclonal [EPR18239] to SIRT1 Host species Rabbit Tested applications Suitable for: IP, ICC/IF, WB, IHC-P, Flow Cyt (Intra)more details Species reactivity Reacts with: Mouse, Rat, Human Immunogen Recombinant fragment. This information is proprietary to Abcam and/or its suppliers. Positive control WB: Mouse testis, colon, kidney, lymph node and liver […]
-
Recombinant Anti-PRKAR1A (phospho S77) antibody [EPMAYR1-127] 100µl | ABCAM | ab139682
Product name Anti-PRKAR1A (phospho S77) antibody [EPMAYR1-127] See all PRKAR1A primary antibodies Description Rabbit monoclonal [EPMAYR1-127] to PRKAR1A (phospho S77) Host species Rabbit Specificity ab139682 only detects Protein Kinase A regulatory subunit I alpha/PRKAR1A phosphorylated at serine 77. Tested applications Suitable for: WBmore details Unsuitable for: ICC or IHC-P Species reactivity Reacts with: Human Predicted to work with: Mouse, […]
-
CP15 North Carolina » Probes | NEXTON | 1504
No. Katalog : 1504 Merk : NEXTON Deskripsi : CP15 North Carolina » Probes adalah alat yang digunakan untuk melokalisir, mengukur, dan menandai saku, serta untuk memperkirakan konfigurasi saku pada setiap sisi gigi. Produk ini terbuat dari material stainless steel yang akan menjaga produk ini tetap kokoh dan terhindar dari karat. Distributed by : CV. […]
-
Anti-TNF alpha antibody [TNFA/1172] | ABCAM | ab220210
Mouse monoclonal [TNFA/1172] to TNF alpha Suitable for: IHC-P, ICC Reacts with: Rat, Human Isotype: IgM Immunogen: Recombinant full length protein corresponding to Human TNF alpha. Positive control: Human Erdheim Chester disease, rat stomach and rat pancreas tissues; ICC: HepG2 cells. pH: 7.2 Preservative: 0.05% Sodium azide Constituents: 0.05% BSA, PBS Concentration: 100 µg at […]
-
SP7 monoclonal antibody (M01), clone 2G6 | ABNOVA | H00121340-M01
Specification Product Description: Mouse monoclonal antibody raised against a partial recombinant SP7. Immunogen: SP7 (NP_690599, 87 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH Host: Mouse Reactivity: Human Interspecies Antigen Sequence: Mouse (94); Rat (94) Isotype: IgG2a Kappa Quality Control Testing: Antibody Reactive Against Recombinant Protein. Western Blot detection against […]
-
Human Gamma-Enolase (ENO2) Elisa Kit | ABBEXA | abx253091
Human Gamma-Enolase (ENO2) ELISA Kit is an ELISA Kit for the in vitro quantitative measurement of Human Gamma-Enolase (ENO2) concentrations in serum, plasma, tissue homogenates, cell lysates and other biological fluids. Target Gamma-Enolase (ENO2) Reactivity Human Tested Applications ELISA Recommended dilutions Optimal dilutions/concentrations should be determined by the end user. Storage Shipped at 4 °C. […]
-
3M steam indikator tape/Autoclave tape size 18 mm
An exposure monitor that securely seals packs, and provides a visual assurance that the package has been exposed to the steam sterilization process. As an exposure monitor, 3M™ Comply Indicator tapes securely seal packs and enables CSSD and OR personnel to know at a glance that the packs have been exposed to the sterilization process. […]
-
Multi Channel Reservoirs, 8 Channel | SPL | 21008
Pengenalan : Bagian bawah Waduk SPL yang miring berguna untuk mengisi pipet-multisaluran selama kultur sel dan eksperimen immunoassay. ▪ Diproduksi dari polistiren yang dimodifikasi ▪ Label volume berlekuk (Kat. No.22050, 23050, 22001, 23001) ▪ Disediakan dalam kemasan steril dalam kemasan 1 atau 5 ▪ Disediakan dalam kemasan non-steril 20 (Kat. No. 23001) Spesifikasi : No. […]
-
Multi Channel Reservoirs, 12 Channel | SPL | 21008
Pengenalan : Bagian bawah Waduk SPL yang miring berguna untuk mengisi pipet-multisaluran selama kultur sel dan eksperimen immunoassay. ▪ Diproduksi dari polistiren yang dimodifikasi ▪ Label volume berlekuk (Kat. No.22050, 23050, 22001, 23001) ▪ Disediakan dalam kemasan steril dalam kemasan 1 atau 5 ▪ Disediakan dalam kemasan non-steril 20 (Kat. No. 23001) Spesifikasi : No. […]
-
Rapid Test Antigen Covid-19 (Oral Fluid) | ACROBIOTECH | INCP-ACO802
Pengenalan : Tes Cepat Antigen COVID-19 (Cairan Oral) adalah immunoassay kromatografi cepat untuk deteksi kualitatif antigen SARS-CoV-2 dalam spesimen cairan oral dari individu dengan dugaan infeksi SARS-CoV-2 sehubungan dengan presentasi klinis dan hasil lain tes laboratorium. Hasilnya untuk deteksi Antigen SARS-CoV-2. Antigen umumnya dapat dideteksi di bagian atas spesimen pernapasan selama fase akut infeksi. Hasil […]