Category: ANTIBODY, CHEMICAL, KIT, REAGENT, AND MEDIA
-
RUNX2 Antibody (FITC) | ANTIBODIES ONLINE | ABIN2751334
Target: RUNX2 Binding Specificity: AA 10-50 Reactivity: Human, Cow, Monkey, Panda Host: Rabbit (Compatible Secondaries) Clonality: Polyclonal Conjugate: This RUNX2 antibody is conjugated to FITC Application: ELISA, Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blotting (WB) Purification: Affinity Purified Immunogen: Synthetic peptide taken within amino acid region 10-50 on human RUNX2 protein. Isotype: IgG *NB: Harga dan berat […]
-
FGF2 Antibody | ANTIBODIES ONLINE | ABIN6334171
Target: IGF2 Reactivity: Rat Host: Mouse (Compatible Secondaries) Clonality: Monoclonal Conjugate: This IGF2 antibody is un-conjugated Application: Immunofluorescence (fixed cells) (IF/ICC), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blotting (WB) Purification: Purified by antigen-specific affinity chromatography followed by Protein A affinity chromatograph *NB: Harga dan berat barang termasuk handling barang
-
HCG Strip (Urine) 100 Strip | ACCU-TELL | ABT-FT-A1
HCG Pregnancy Rapid Test Strip (Serum/Plasma/Urine) is a One Step chromatographic immunoassay for the qualitative detection of human chorionic gonadotropin in urine or serum or plasma to aid in the early detection of pregnancy. Human chorionic gonadotropin(HCG) is a glycoprotein hormone produced by the developing placenta shortly after fertilization. In normal pregnancy, HCG can be […]
-
HBSAg Cassette (Whole Blood/Serum/Plasma) 50 Test/box | ACCU-TELL | ABT-IDT-B6
HBsAg Rapid Test Cassette/Strip (Whole Blood /Serum/Plasma) is a rapid chromatographic immunoassay for the qualitative detection of Hepatitis B Surface Antigen in whole blood, serum or plasma. Viral hepatitis is a systemic disease primarily involving the liver. Most cases of acute viral hepatitis are caused by Hepatitis A virus, Hepatitis B virus (HBV) or Hepatitis […]
-
Recombinant Anti-SIRT1 antibody [EPR18239] 100µl | ABCAM | ab189494
Product name Anti-SIRT1 antibody [EPR18239] See all SIRT1 primary antibodies Description Rabbit monoclonal [EPR18239] to SIRT1 Host species Rabbit Tested applications Suitable for: IP, ICC/IF, WB, IHC-P, Flow Cyt (Intra)more details Species reactivity Reacts with: Mouse, Rat, Human Immunogen Recombinant fragment. This information is proprietary to Abcam and/or its suppliers. Positive control WB: Mouse testis, colon, kidney, lymph node and liver […]
-
Recombinant Anti-PRKAR1A (phospho S77) antibody [EPMAYR1-127] 100µl | ABCAM | ab139682
Product name Anti-PRKAR1A (phospho S77) antibody [EPMAYR1-127] See all PRKAR1A primary antibodies Description Rabbit monoclonal [EPMAYR1-127] to PRKAR1A (phospho S77) Host species Rabbit Specificity ab139682 only detects Protein Kinase A regulatory subunit I alpha/PRKAR1A phosphorylated at serine 77. Tested applications Suitable for: WBmore details Unsuitable for: ICC or IHC-P Species reactivity Reacts with: Human Predicted to work with: Mouse, […]
-
Anti-TNF alpha antibody [TNFA/1172] | ABCAM | ab220210
Mouse monoclonal [TNFA/1172] to TNF alpha Suitable for: IHC-P, ICC Reacts with: Rat, Human Isotype: IgM Immunogen: Recombinant full length protein corresponding to Human TNF alpha. Positive control: Human Erdheim Chester disease, rat stomach and rat pancreas tissues; ICC: HepG2 cells. pH: 7.2 Preservative: 0.05% Sodium azide Constituents: 0.05% BSA, PBS Concentration: 100 µg at […]
-
SP7 monoclonal antibody (M01), clone 2G6 | ABNOVA | H00121340-M01
Specification Product Description: Mouse monoclonal antibody raised against a partial recombinant SP7. Immunogen: SP7 (NP_690599, 87 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH Host: Mouse Reactivity: Human Interspecies Antigen Sequence: Mouse (94); Rat (94) Isotype: IgG2a Kappa Quality Control Testing: Antibody Reactive Against Recombinant Protein. Western Blot detection against […]
-
Human Gamma-Enolase (ENO2) Elisa Kit | ABBEXA | abx253091
Human Gamma-Enolase (ENO2) ELISA Kit is an ELISA Kit for the in vitro quantitative measurement of Human Gamma-Enolase (ENO2) concentrations in serum, plasma, tissue homogenates, cell lysates and other biological fluids. Target Gamma-Enolase (ENO2) Reactivity Human Tested Applications ELISA Recommended dilutions Optimal dilutions/concentrations should be determined by the end user. Storage Shipped at 4 °C. […]
-
Rapid Test Antigen Covid-19 (Oral Fluid) | ACROBIOTECH | INCP-ACO802
Pengenalan : Tes Cepat Antigen COVID-19 (Cairan Oral) adalah immunoassay kromatografi cepat untuk deteksi kualitatif antigen SARS-CoV-2 dalam spesimen cairan oral dari individu dengan dugaan infeksi SARS-CoV-2 sehubungan dengan presentasi klinis dan hasil lain tes laboratorium. Hasilnya untuk deteksi Antigen SARS-CoV-2. Antigen umumnya dapat dideteksi di bagian atas spesimen pernapasan selama fase akut infeksi. Hasil […]
-
Rapid Test Antigen Covid-19 (Nasopharyngeal Swab) | ACROBIOTECH | INCP-ACO502
Pengenalan : Uji Cepat Antigen COVID-19 (Nasopharyngeal Swab) adalah kromatografi cepat immunoassay untuk deteksi kualitatif antigen SARS-CoV-2 pada usap nasofaring spesimen dari individu dengan dugaan infeksi SARS-CoV-2 sehubungan dengan klinis presentasi dan hasil pemeriksaan laboratorium lainnya. Hasilnya untuk deteksi Antigen SARS-CoV-2. Antigen umumnya dapat dideteksi di bagian atas spesimen pernapasan selama fase akut infeksi. Hasil […]
-
Tray 10,5 cm x 8,3 cm | BT Lab System | BT 105-E
100% Original BT Lab System Ukuran : 10,5 x 8,3cm Warna : Bening / Transparant Kegunaan : Tray ini diletakkan di dalam casting tray untuk wadah agarose agar lebih mudal diambil dari casting tray