Category: ANTIBODY, CHEMICAL, KIT, REAGENT, AND MEDIA


  • RUNX2 Antibody (FITC) | ANTIBODIES ONLINE | ABIN2751334

    Target: RUNX2 Binding Specificity: AA 10-50 Reactivity: Human, Cow, Monkey, Panda Host: Rabbit (Compatible Secondaries) Clonality: Polyclonal Conjugate: This RUNX2 antibody is conjugated to FITC Application: ELISA, Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blotting (WB) Purification: Affinity Purified Immunogen: Synthetic peptide taken within amino acid region 10-50 on human RUNX2 protein. Isotype: IgG     *NB: Harga dan berat […]


  • FGF2 Antibody | ANTIBODIES ONLINE | ABIN6334171

    Target: IGF2 Reactivity: Rat Host: Mouse (Compatible Secondaries) Clonality: Monoclonal Conjugate: This IGF2 antibody is un-conjugated Application: Immunofluorescence (fixed cells) (IF/ICC), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blotting (WB) Purification: Purified by antigen-specific affinity chromatography followed by Protein A affinity chromatograph     *NB: Harga dan berat barang termasuk handling barang


  • HCG Strip (Urine) 100 Strip | ACCU-TELL | ABT-FT-A1

    HCG Pregnancy Rapid Test Strip (Serum/Plasma/Urine) is a One Step chromatographic immunoassay for the qualitative detection of human chorionic gonadotropin in urine or serum or plasma to aid in the early detection of pregnancy. Human chorionic gonadotropin(HCG) is a glycoprotein hormone produced by the developing placenta shortly after fertilization. In normal pregnancy, HCG can be […]


  • HBSAg Cassette (Whole Blood/Serum/Plasma) 50 Test/box | ACCU-TELL | ABT-IDT-B6

    HBsAg Rapid Test Cassette/Strip (Whole Blood /Serum/Plasma) is a rapid chromatographic immunoassay for the qualitative detection of Hepatitis B Surface Antigen in whole blood, serum or plasma. Viral hepatitis is a systemic disease primarily involving the liver. Most cases of acute viral hepatitis are caused by Hepatitis A virus, Hepatitis B virus (HBV) or Hepatitis […]


  • Recombinant Anti-SIRT1 antibody [EPR18239] 100µl | ABCAM | ab189494

    Product name Anti-SIRT1 antibody [EPR18239] See all SIRT1 primary antibodies Description Rabbit monoclonal [EPR18239] to SIRT1 Host species Rabbit Tested applications Suitable for: IP, ICC/IF, WB, IHC-P, Flow Cyt (Intra)more details Species reactivity Reacts with: Mouse, Rat, Human Immunogen Recombinant fragment. This information is proprietary to Abcam and/or its suppliers. Positive control WB: Mouse testis, colon, kidney, lymph node and liver […]


  • Recombinant Anti-PRKAR1A (phospho S77) antibody [EPMAYR1-127] 100µl | ABCAM | ab139682

    Product name Anti-PRKAR1A (phospho S77) antibody [EPMAYR1-127] See all PRKAR1A primary antibodies Description Rabbit monoclonal [EPMAYR1-127] to PRKAR1A (phospho S77) Host species Rabbit Specificity ab139682 only detects Protein Kinase A regulatory subunit I alpha/PRKAR1A phosphorylated at serine 77. Tested applications Suitable for: WBmore details Unsuitable for: ICC or IHC-P Species reactivity Reacts with: Human Predicted to work with: Mouse, […]


  • Anti-TNF alpha antibody [TNFA/1172] | ABCAM | ab220210

    Mouse monoclonal [TNFA/1172] to TNF alpha Suitable for: IHC-P, ICC Reacts with: Rat, Human Isotype: IgM Immunogen: Recombinant full length protein corresponding to Human TNF alpha. Positive control: Human Erdheim Chester disease, rat stomach and rat pancreas tissues; ICC: HepG2 cells. pH: 7.2 Preservative: 0.05% Sodium azide Constituents: 0.05% BSA, PBS Concentration: 100 µg at […]


  • SP7 monoclonal antibody (M01), clone 2G6 | ABNOVA | H00121340-M01

    Specification Product Description: Mouse monoclonal antibody raised against a partial recombinant SP7. Immunogen: SP7 (NP_690599, 87 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH Host: Mouse Reactivity: Human Interspecies Antigen Sequence: Mouse (94); Rat (94) Isotype: IgG2a Kappa Quality Control Testing: Antibody Reactive Against Recombinant Protein. Western Blot detection against […]


  • Human Gamma-Enolase (ENO2) Elisa Kit | ABBEXA | abx253091

    Human Gamma-Enolase (ENO2) ELISA Kit is an ELISA Kit for the in vitro quantitative measurement of Human Gamma-Enolase (ENO2) concentrations in serum, plasma, tissue homogenates, cell lysates and other biological fluids. Target Gamma-Enolase (ENO2) Reactivity Human Tested Applications ELISA Recommended dilutions Optimal dilutions/concentrations should be determined by the end user. Storage Shipped at 4 °C. […]


  • Rapid Test Antigen Covid-19 (Oral Fluid) | ACROBIOTECH | INCP-ACO802

    Pengenalan : Tes Cepat Antigen COVID-19 (Cairan Oral) adalah immunoassay kromatografi cepat untuk deteksi kualitatif antigen SARS-CoV-2 dalam spesimen cairan oral dari individu dengan dugaan infeksi SARS-CoV-2 sehubungan dengan presentasi klinis dan hasil lain tes laboratorium. Hasilnya untuk deteksi Antigen SARS-CoV-2. Antigen umumnya dapat dideteksi di bagian atas spesimen pernapasan selama fase akut infeksi. Hasil […]


  • Rapid Test Antigen Covid-19 (Nasopharyngeal Swab) | ACROBIOTECH | INCP-ACO502

    Pengenalan : Uji Cepat Antigen COVID-19 (Nasopharyngeal Swab) adalah kromatografi cepat immunoassay untuk deteksi kualitatif antigen SARS-CoV-2 pada usap nasofaring spesimen dari individu dengan dugaan infeksi SARS-CoV-2 sehubungan dengan klinis presentasi dan hasil pemeriksaan laboratorium lainnya. Hasilnya untuk deteksi Antigen SARS-CoV-2. Antigen umumnya dapat dideteksi di bagian atas spesimen pernapasan selama fase akut infeksi. Hasil […]


  • Tray 10,5 cm x 8,3 cm | BT Lab System | BT 105-E

    100% Original BT Lab System Ukuran : 10,5 x 8,3cm Warna : Bening / Transparant Kegunaan : Tray ini diletakkan di dalam casting tray untuk wadah agarose agar lebih mudal diambil dari casting tray

error: Content is protected !!