Tag: antibody
-
Recombinant Anti-SIRT1 antibody [EPR18239] 100µl | ABCAM | ab189494
Product name Anti-SIRT1 antibody [EPR18239] See all SIRT1 primary antibodies Description Rabbit monoclonal [EPR18239] to SIRT1 Host species Rabbit Tested applications Suitable for: IP, ICC/IF, WB, IHC-P, Flow Cyt (Intra)more details Species reactivity Reacts with: Mouse, Rat, Human Immunogen Recombinant fragment. This information is proprietary to Abcam and/or its suppliers. Positive control WB: Mouse testis, colon, kidney, lymph node and liver […]
-
Recombinant Anti-PRKAR1A (phospho S77) antibody [EPMAYR1-127] 100µl | ABCAM | ab139682
Product name Anti-PRKAR1A (phospho S77) antibody [EPMAYR1-127] See all PRKAR1A primary antibodies Description Rabbit monoclonal [EPMAYR1-127] to PRKAR1A (phospho S77) Host species Rabbit Specificity ab139682 only detects Protein Kinase A regulatory subunit I alpha/PRKAR1A phosphorylated at serine 77. Tested applications Suitable for: WBmore details Unsuitable for: ICC or IHC-P Species reactivity Reacts with: Human Predicted to work with: Mouse, […]
-
Anti-TNF alpha antibody [TNFA/1172] | ABCAM | ab220210
Mouse monoclonal [TNFA/1172] to TNF alpha Suitable for: IHC-P, ICC Reacts with: Rat, Human Isotype: IgM Immunogen: Recombinant full length protein corresponding to Human TNF alpha. Positive control: Human Erdheim Chester disease, rat stomach and rat pancreas tissues; ICC: HepG2 cells. pH: 7.2 Preservative: 0.05% Sodium azide Constituents: 0.05% BSA, PBS Concentration: 100 µg at […]
-
SP7 monoclonal antibody (M01), clone 2G6 | ABNOVA | H00121340-M01
Specification Product Description: Mouse monoclonal antibody raised against a partial recombinant SP7. Immunogen: SP7 (NP_690599, 87 a.a. ~ 162 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: GYANDYPPFSHSFPGPTGTQDPGLLVPKGHSSSDCLPSVYTSLDMTHPYGSWYKAGIHAGISPGPGNTPTPWWDMH Host: Mouse Reactivity: Human Interspecies Antigen Sequence: Mouse (94); Rat (94) Isotype: IgG2a Kappa Quality Control Testing: Antibody Reactive Against Recombinant Protein. Western Blot detection against […]
-
Kinetin 100mg | ABMOLE | M2793
Biological Activity Kinetin is a kind of cytokinin, a class of plant hormone that promotes cell division. Conversion of different model animals based on BSA (Value based on data from FDA Draft Guidelines) Species Mouse Rat Rabbit Guinea pig Hamster Dog Weight (kg) 0.02 0.15 1.8 0.4 0.08 10 Body Surface Area (m2) 0.007 0.025 […]
-
HPI-4 10 mg | ABMOLE | M6149
Biological Activity In vitro: HPI-4 does not directly target Smo. It counteracts the activities of endogenous Gli1 and Gli2 but does not directly act on transcription factor GLIs. HPI-4 significantly inhibited the proliferation of these neuronal progenitors, as measured by histone H3 phosphorylation (pH3) levels, It also reduced cellular levels of cyclin D1 protein and […]